SFRS15 purified MaxPab mouse polyclonal antibody (B01P)
  • SFRS15 purified MaxPab mouse polyclonal antibody (B01P)

SFRS15 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00057466-B01P
SFRS15 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human SFRS15 protein.
Información adicional
Size 50 ug
Gene Name SFRS15
Gene Alias DKFZp434E098|FLJ23364|KIAA1172|SCAF4|SRA4
Gene Description splicing factor, arginine/serine-rich 15
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MDAVNAFNQELFSLMDMKPPISRAKMILITKAAIKAIKLYKHVVQIVEKFIKKCKPEYKVPGLYVIDSIVRQSRHQFGTDKDVFGPRFSKNITATFQYLYLCPSEDKSKIVRVLNLWQKNGVFKIEIIQPLLDMAAGTSNAAPVAENVTNNEGSPPPPVKVSSEPPTQATPNSVPAVPQLPSSDAFAAVAQLFQTTQGQQLQQILQTFQQPPKPQSPALDNAVMAQVQAITAQLKTTPTQPSEQKAAFPPPEQKT
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SFRS15 (NP_065757.1, 1 a.a. ~ 1147 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 57466

Enviar un mensaje


SFRS15 purified MaxPab mouse polyclonal antibody (B01P)

SFRS15 purified MaxPab mouse polyclonal antibody (B01P)