PLEKHG5 monoclonal antibody (M01), clone 5A9
  • PLEKHG5 monoclonal antibody (M01), clone 5A9

PLEKHG5 monoclonal antibody (M01), clone 5A9

Ref: AB-H00057449-M01
PLEKHG5 monoclonal antibody (M01), clone 5A9

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PLEKHG5.
Información adicional
Size 100 ug
Gene Name PLEKHG5
Gene Alias DSMA4|GEF720|KIAA0720|RP4-650H14.3
Gene Description pleckstrin homology domain containing, family G (with RhoGef domain) member 5
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,IHC-P,S-ELISA,ELISA,IF
Immunogen Prot. Seq SAPSRSLSELCLAVPAPGIRTQGSPQEAGPSWDCRGAPSPGSGPGLVGCLAGEPAGSHRKRCGDLPSGASPRVQPEPPPGVSAQHRKLTLAQLYRIRTTL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PLEKHG5 (NP_065682, 896 a.a. ~ 995 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 57449
Clone Number 5A9
Iso type IgG2a Kappa

Enviar un mensaje


PLEKHG5 monoclonal antibody (M01), clone 5A9

PLEKHG5 monoclonal antibody (M01), clone 5A9