PLEKHG5 polyclonal antibody (A01)
  • PLEKHG5 polyclonal antibody (A01)

PLEKHG5 polyclonal antibody (A01)

Ref: AB-H00057449-A01
PLEKHG5 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant PLEKHG5.
Información adicional
Size 50 uL
Gene Name PLEKHG5
Gene Alias DSMA4|GEF720|KIAA0720|RP4-650H14.3
Gene Description pleckstrin homology domain containing, family G (with RhoGef domain) member 5
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq SAPSRSLSELCLAVPAPGIRTQGSPQEAGPSWDCRGAPSPGSGPGLVGCLAGEPAGSHRKRCGDLPSGASPRVQPEPPPGVSAQHRKLTLAQLYRIRTTL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PLEKHG5 (NP_065682, 896 a.a. ~ 995 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 57449

Enviar un mensaje


PLEKHG5 polyclonal antibody (A01)

PLEKHG5 polyclonal antibody (A01)