NDRG2 monoclonal antibody (M03), clone 6A5
  • NDRG2 monoclonal antibody (M03), clone 6A5

NDRG2 monoclonal antibody (M03), clone 6A5

Ref: AB-H00057447-M03
NDRG2 monoclonal antibody (M03), clone 6A5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant NDRG2.
Información adicional
Size 100 ug
Gene Name NDRG2
Gene Alias DKFZp781G1938|FLJ25522|KIAA1248|SYLD
Gene Description NDRG family member 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MAELQEVQITEEKPLLPGQTPEAAKTHSVETPYGSVTFTVYGTPKPKRPAILTYHDVGLNYKSCFQPLFQFEDMQEIIQNFVRVHVDAPGMEEGAP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NDRG2 (NP_057334, 1 a.a. ~ 96 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 57447
Clone Number 6A5
Iso type IgG1 Kappa

Enviar un mensaje


NDRG2 monoclonal antibody (M03), clone 6A5

NDRG2 monoclonal antibody (M03), clone 6A5