NDRG2 polyclonal antibody (A01)
  • NDRG2 polyclonal antibody (A01)

NDRG2 polyclonal antibody (A01)

Ref: AB-H00057447-A01
NDRG2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant NDRG2.
Información adicional
Size 50 uL
Gene Name NDRG2
Gene Alias DKFZp781G1938|FLJ25522|KIAA1248|SYLD
Gene Description NDRG family member 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MAELQEVQITEEKPLLPGQTPEAAKTHSVETPYGSVTFTVYGTPKPKRPAILTYHDVGLNYKSCFQPLFQFEDMQEIIQNFVRVHVDAPGMEEGAP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NDRG2 (NP_057334, 1 a.a. ~ 96 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 57447

Enviar un mensaje


NDRG2 polyclonal antibody (A01)

NDRG2 polyclonal antibody (A01)