AS3MT purified MaxPab mouse polyclonal antibody (B01P)
  • AS3MT purified MaxPab mouse polyclonal antibody (B01P)

AS3MT purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00057412-B01P
AS3MT purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human AS3MT protein.
Información adicional
Size 50 ug
Gene Name AS3MT
Gene Alias CYT19
Gene Description arsenic (+3 oxidation state) methyltransferase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MAALRDAEIQKDVQTYYGQVLKRSADLQTNGCVTTARPVPKHIREALQNVHEEVALRYYGCGLVIPEHLENCWILDLGSGSGRDCYVLSQLVGEKGHVTGIDMTKGQVEVAEKYLDYHMEKYGFQASNVTFIHGYIEKLGEAGIKNESHDIVVSNCVINLVPDKQQVLQEAYRVLKHGGELYFSDVYTSLELPEEIRTHKVLWGECLGGALYWKELAVLAQKIGFCPPRLVTANLITIQNKELERVIGDCRFVSA
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen AS3MT (AAI60057.1, 1 a.a. ~ 375 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 57412

Enviar un mensaje


AS3MT purified MaxPab mouse polyclonal antibody (B01P)

AS3MT purified MaxPab mouse polyclonal antibody (B01P)