MIF4GD purified MaxPab mouse polyclonal antibody (B01P)
  • MIF4GD purified MaxPab mouse polyclonal antibody (B01P)

MIF4GD purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00057409-B01P
MIF4GD purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human MIF4GD protein.
Información adicional
Size 50 ug
Gene Name MIF4GD
Gene Alias AD023|MGC45027|MIFD|SLIP1
Gene Description MIF4G domain containing
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MGEPSREEYKIQSFDAETQQLLKTALKVACFETEDGEYSVCQRSYSNCSRLMPSRCNTQYRDPGAVDLEKVANVIVDHSLQDCVFSKEAGRMCYAIIQAESKQAGQSVFRRGLLNRLQQEYQAREQLRARSLQGWVCYVTFICNIFDYLRVNNMPMMALVNPVYDCLFRLAQPDSLSKEEEVDCLVLQLHRVGEQLEKMNGQRMDELFVLIRDGFLLPTGLSSLAQLLLLEIIEFRAAGWKTTPAAHKYYYSEVS
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen MIF4GD (NP_065730.2, 1 a.a. ~ 256 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 57409

Enviar un mensaje


MIF4GD purified MaxPab mouse polyclonal antibody (B01P)

MIF4GD purified MaxPab mouse polyclonal antibody (B01P)