RAB22A monoclonal antibody (M03), clone 2B12
  • RAB22A monoclonal antibody (M03), clone 2B12

RAB22A monoclonal antibody (M03), clone 2B12

Ref: AB-H00057403-M03
RAB22A monoclonal antibody (M03), clone 2B12

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant RAB22A.
Información adicional
Size 100 ug
Gene Name RAB22A
Gene Alias MGC16770
Gene Description RAB22A, member RAS oncogene family
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MALRELRVCLLGDTGVGKSSIVWRFVEDSFDPNINPTIGASFMTKTVQYQNELHKFLIWDTAGQERFRALAPMYYRGSAAAIIVYDITKEETFSTLKNWVKELRRHGPPNIVVAIAGNKCDLIDVREVMERDAKDYADSIHAIFVETSAKNAININELFIEISRRIPSTDANLPSGGKGFKLRRQPSEPKRSCC
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RAB22A (AAH15710, 1 a.a. ~ 194 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 57403
Clone Number 2B12
Iso type IgG2b Kappa

Enviar un mensaje


RAB22A monoclonal antibody (M03), clone 2B12

RAB22A monoclonal antibody (M03), clone 2B12