RAB22A MaxPab rabbit polyclonal antibody (D01)
  • RAB22A MaxPab rabbit polyclonal antibody (D01)

RAB22A MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00057403-D01
RAB22A MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human RAB22A protein.
Información adicional
Size 100 uL
Gene Name RAB22A
Gene Alias MGC16770
Gene Description RAB22A, member RAS oncogene family
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key IP
Immunogen Prot. Seq MALRELRVCLLGDTGVGKSSIVWRFVEDSFDPNINPTIGASFMTKTVQYQNELHKFLIWDTAGQERFRALAPMYYRGSAAAIIVYDITKEETFSTLKNWVKELRRHGPPNIVVAIAGNKCDLIDVREVMERDAKDYADSIHAIFVETSAKNAININELFIEISRRIPSTDANLPSGGKGFKLRRQPSEPKRSCC
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen RAB22A (AAH15710.1, 1 a.a. ~ 194 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 57403

Enviar un mensaje


RAB22A MaxPab rabbit polyclonal antibody (D01)

RAB22A MaxPab rabbit polyclonal antibody (D01)