MRS2L monoclonal antibody (M03), clone 1E2
  • MRS2L monoclonal antibody (M03), clone 1E2

MRS2L monoclonal antibody (M03), clone 1E2

Ref: AB-H00057380-M03
MRS2L monoclonal antibody (M03), clone 1E2

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant MRS2L.
Información adicional
Size 100 ug
Gene Name MRS2
Gene Alias HPT|MGC78523|MRS2L
Gene Description MRS2 magnesium homeostasis factor homolog (S. cerevisiae)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA
Immunogen Prot. Seq MECLRSLPCLLPRAMRLPRRTLCALALDVTSVGPPVAACGRRANLIGRSRAAQLCGPDRLRVAGEVHRFRTSDVSQATLASVAPVFTVTKFDKQGNVTSFVFESCDNSRVSSDIRLS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MRS2L (AAH01028, 1 a.a. ~ 117 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 57380
Clone Number 1E2
Iso type IgG2a Kappa

Enviar un mensaje


MRS2L monoclonal antibody (M03), clone 1E2

MRS2L monoclonal antibody (M03), clone 1E2