GJD2 monoclonal antibody (M03), clone 5E5
  • GJD2 monoclonal antibody (M03), clone 5E5

GJD2 monoclonal antibody (M03), clone 5E5

Ref: AB-H00057369-M03
GJD2 monoclonal antibody (M03), clone 5E5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant GJD2.
Información adicional
Size 100 ug
Gene Name GJD2
Gene Alias CX36|GJA9|MGC138315|MGC138319
Gene Description gap junction protein, delta 2, 36kDa
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq HQSAKQRERRYSTVFLALDRDPPESIGGPGGTGGGGSGGGKREDKKLQNAIVNGVLQNTENTSKETEPDCLEVKELTPHPSGLRTASKSKLRRQEGISR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GJD2 (NP_065711.1, 99 a.a. ~ 197 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 57369
Clone Number 5E5
Iso type IgG2a Kappa

Enviar un mensaje


GJD2 monoclonal antibody (M03), clone 5E5

GJD2 monoclonal antibody (M03), clone 5E5