TTYH1 monoclonal antibody (M04), clone 4A9
  • TTYH1 monoclonal antibody (M04), clone 4A9

TTYH1 monoclonal antibody (M04), clone 4A9

Ref: AB-H00057348-M04
TTYH1 monoclonal antibody (M04), clone 4A9

Información del producto

Mouse monoclonal antibody raised against a partial recombinant TTYH1.
Información adicional
Size 100 ug
Gene Name TTYH1
Gene Alias -
Gene Description tweety homolog 1 (Drosophila)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MGLEAATAVGLSDFCSNPDPYVLNLTQEETGLSSDILSYYLLCNRAVSNPFQQRLTLSQRALANIHSQLLGLEREAVPQFPSAQKPLLSLEETLNVTEGN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TTYH1 (NP_065710, 261 a.a. ~ 360 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 57348
Clone Number 4A9
Iso type IgG2a Kappa

Enviar un mensaje


TTYH1 monoclonal antibody (M04), clone 4A9

TTYH1 monoclonal antibody (M04), clone 4A9