SENP7 monoclonal antibody (M01), clone 2D4
  • SENP7 monoclonal antibody (M01), clone 2D4

SENP7 monoclonal antibody (M01), clone 2D4

Ref: AB-H00057337-M01
SENP7 monoclonal antibody (M01), clone 2D4

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SENP7.
Información adicional
Size 100 ug
Gene Name SENP7
Gene Alias KIAA1707|MGC157730
Gene Description SUMO1/sentrin specific peptidase 7
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA,IF
Immunogen Prot. Seq MDKRKLGRRPSSSEIITEGKRKKSSSDLSEIRKMLNAKPEDVHVQSPLSKFRSSERWTLPLQWERSLRNKVISLDHKNKKHIRGCPVTSRSSPERIPRVILTNVLGTELG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SENP7 (NP_065705, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 57337
Clone Number 2D4
Iso type IgG2a Kappa

Enviar un mensaje


SENP7 monoclonal antibody (M01), clone 2D4

SENP7 monoclonal antibody (M01), clone 2D4