SENP7 polyclonal antibody (A01)
  • SENP7 polyclonal antibody (A01)

SENP7 polyclonal antibody (A01)

Ref: AB-H00057337-A01
SENP7 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant SENP7.
Información adicional
Size 50 uL
Gene Name SENP7
Gene Alias KIAA1707|MGC157730
Gene Description SUMO1/sentrin specific peptidase 7
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MDKRKLGRRPSSSEIITEGKRKKSSSDLSEIRKMLNAKPEDVHVQSPLSKFRSSERWTLPLQWERSLRNKVISLDHKNKKHIRGCPVTSRSSPERIPRVILTNVLGTELG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SENP7 (NP_065705, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 57337

Enviar un mensaje


SENP7 polyclonal antibody (A01)

SENP7 polyclonal antibody (A01)