SNX14 polyclonal antibody (A01)
  • SNX14 polyclonal antibody (A01)

SNX14 polyclonal antibody (A01)

Ref: AB-H00057231-A01
SNX14 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant SNX14.
Información adicional
Size 50 uL
Gene Name SNX14
Gene Alias MGC13217|RGS-PX2
Gene Description sorting nexin 14
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq QLFQEHRLVSLITLLRDAIFCENTEPRSLQDKQKGAKQTFEEMMNYIPDLLVKCIGEETKYESIRLLFDGLQQPVLNKQLTYVLLDIVIQELFPELNKVQKEVTSVTSWM
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SNX14 (AAH05110, 784 a.a. ~ 893 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 57231

Enviar un mensaje


SNX14 polyclonal antibody (A01)

SNX14 polyclonal antibody (A01)