THAP11 monoclonal antibody (M01), clone 3C11
  • THAP11 monoclonal antibody (M01), clone 3C11

THAP11 monoclonal antibody (M01), clone 3C11

Ref: AB-H00057215-M01
THAP11 monoclonal antibody (M01), clone 3C11

Información del producto

Mouse monoclonal antibody raised against a partial recombinant THAP11.
Información adicional
Size 100 ug
Gene Name THAP11
Gene Alias CTG-B43a|CTG-B45d|HRIHFB2206|RONIN
Gene Description THAP domain containing 11
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA,IF
Immunogen Prot. Seq MPGFTCCVPGCYNNSHRDKALHFYTFPKDAELRRLWLKNVSRAGVSGCFSTFQPTTGHRLCSVHFQGGRKTYTVRVPTIFPLRGV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen THAP11 (NP_065190.2, 1 a.a. ~ 85 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 57215
Clone Number 3C11
Iso type IgG2b Kappa

Enviar un mensaje


THAP11 monoclonal antibody (M01), clone 3C11

THAP11 monoclonal antibody (M01), clone 3C11