KIAA1199 purified MaxPab rabbit polyclonal antibody (D01P)
  • KIAA1199 purified MaxPab rabbit polyclonal antibody (D01P)

KIAA1199 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00057214-D01P
KIAA1199 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human KIAA1199 protein.
Información adicional
Size 100 ug
Gene Name KIAA1199
Gene Alias TMEM2L
Gene Description KIAA1199
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MGAAGRQDFLFKAMLTISWLTLTCFPGATSTVAAGCPDQSPELQPWNPGHDQDHHVHIGQGKTLLLTSSATVYSIHISEGGKLVIKDHDEPIVLRTRHILIDNGGELHAGSALCPFQGNFTIILYGRADEGIQPDPYYGLKYIGVGKGGALELHGQKKLSWTFLNKTLHPGGMAEGGYFFERSWGHRGVIVHVIDPKSGTVIHSDRFDTYRSKKESERLVQYLNAVPDGRILSVAVNDEGSRNLDDMARKAMTKL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen KIAA1199 (AAH20256.1, 1 a.a. ~ 992 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 57214

Enviar un mensaje


KIAA1199 purified MaxPab rabbit polyclonal antibody (D01P)

KIAA1199 purified MaxPab rabbit polyclonal antibody (D01P)