C13orf1 monoclonal antibody (M01), clone 2G4
  • C13orf1 monoclonal antibody (M01), clone 2G4

C13orf1 monoclonal antibody (M01), clone 2G4

Ref: AB-H00057213-M01
C13orf1 monoclonal antibody (M01), clone 2G4

Información del producto

Mouse monoclonal antibody raised against a partial recombinant C13orf1.
Información adicional
Size 100 ug
Gene Name C13orf1
Gene Alias CLLD6
Gene Description chromosome 13 open reading frame 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq MHSLVMRNDGALYHNNEEKNRLPANSLPQEGDVVGITYDHVELNVYLNGKNMHCPASGIRGTVYPVVYVDDSAILDCQFSEFYHTPPPGFEKILFEQQIF
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen C13orf1 (NP_065189, 97 a.a. ~ 196 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 57213
Clone Number 2G4
Iso type IgG1 Kappa

Enviar un mensaje


C13orf1 monoclonal antibody (M01), clone 2G4

C13orf1 monoclonal antibody (M01), clone 2G4