SLC45A4 monoclonal antibody (M01), clone 1A1
  • SLC45A4 monoclonal antibody (M01), clone 1A1

SLC45A4 monoclonal antibody (M01), clone 1A1

Ref: AB-H00057210-M01
SLC45A4 monoclonal antibody (M01), clone 1A1

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant SLC45A4.
Información adicional
Size 100 ug
Gene Name SLC45A4
Gene Alias KIAA1126
Gene Description solute carrier family 45, member 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MDTFSHAVSLLNFGPALATTQRVRDCCCGVSLVCPSASHQHAPLLRDTSSLPPSLVPQACREGPLLPRAPGGVLPFTTWERCQFSSELNKARAHSMLGAQPKVLVTSSCKASHHPPARAQGGPLASPSLGPPGGLSTPPSGIPCPPQCCQGHVALCRGLRPSPGDRMTRLLEMPRCQRNSPGISERNYLVPL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SLC45A4 (AAH33223.1, 1 a.a. ~ 192 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 57210
Clone Number 1A1
Iso type IgG2a Kappa

Enviar un mensaje


SLC45A4 monoclonal antibody (M01), clone 1A1

SLC45A4 monoclonal antibody (M01), clone 1A1