SLC39A10 monoclonal antibody (M03), clone 1F6
  • SLC39A10 monoclonal antibody (M03), clone 1F6

SLC39A10 monoclonal antibody (M03), clone 1F6

Ref: AB-H00057181-M03
SLC39A10 monoclonal antibody (M03), clone 1F6

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SLC39A10.
Información adicional
Size 100 ug
Gene Name SLC39A10
Gene Alias DKFZp781L10106|LZT-Hs2|MGC126565|MGC138428
Gene Description solute carrier family 39 (zinc transporter), member 10
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq CIRMFKHYKQQRGKQKWFMKQNTEESTIGRKLSDHKLNNTPDSDWLQLKPLAGTDDSVVSEDRLNETELTDLEGQQESPPKNYLCIEEEKIIDHSHSDGLHTIHEHDL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SLC39A10 (NP_065075, 514 a.a. ~ 621 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 57181
Clone Number 1F6
Iso type IgG1 Kappa

Enviar un mensaje


SLC39A10 monoclonal antibody (M03), clone 1F6

SLC39A10 monoclonal antibody (M03), clone 1F6