SLC39A10 polyclonal antibody (A01)
  • SLC39A10 polyclonal antibody (A01)

SLC39A10 polyclonal antibody (A01)

Ref: AB-H00057181-A01
SLC39A10 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant SLC39A10.
Información adicional
Size 50 uL
Gene Name SLC39A10
Gene Alias DKFZp781L10106|LZT-Hs2|MGC126565|MGC138428
Gene Description solute carrier family 39 (zinc transporter), member 10
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq CIRMFKHYKQQRGKQKWFMKQNTEESTIGRKLSDHKLNNTPDSDWLQLKPLAGTDDSVVSEDRLNETELTDLEGQQESPPKNYLCIEEEKIIDHSHSDGLHTIHEHDL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SLC39A10 (NP_065075, 514 a.a. ~ 621 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 57181

Enviar un mensaje


SLC39A10 polyclonal antibody (A01)

SLC39A10 polyclonal antibody (A01)