CORO1B monoclonal antibody (M02), clone 1A10
  • CORO1B monoclonal antibody (M02), clone 1A10

CORO1B monoclonal antibody (M02), clone 1A10

Ref: AB-H00057175-M02
CORO1B monoclonal antibody (M02), clone 1A10

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant CORO1B.
Información adicional
Size 100 ug
Gene Name CORO1B
Gene Alias CORONIN-2|DKFZp762I166
Gene Description coronin, actin binding protein, 1B
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq MSFRKVVRQSKFRHVFGQPVKNDQCYEDIRVSRVTWDSTFCAVNPKFLAVIVEASGGGAFLVLPLSKTGRIDKAYPTVCGHTGPVLDIDWCPHNDEVIASGSEDCTVMVWQIPENGLTSPLTEPVVVLEGHTKRVGIIAWHPTARNVLLSAGCDNVVLIWNVGTAEELYRLDSLHPDLIYNVSWNHNGSLFCSACKDKSVRIIDPRRGTLVAEREKAHEGARPMRAIFLADGKVFTTGFSRMSERQLALWDPENL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CORO1B (AAH06449, 1 a.a. ~ 489 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 57175
Clone Number 1A10
Iso type IgG1 Kappa

Enviar un mensaje


CORO1B monoclonal antibody (M02), clone 1A10

CORO1B monoclonal antibody (M02), clone 1A10