SALL4 polyclonal antibody (A01)
  • SALL4 polyclonal antibody (A01)

SALL4 polyclonal antibody (A01)

Ref: AB-H00057167-A01
SALL4 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant SALL4.
Información adicional
Size 50 uL
Gene Name SALL4
Gene Alias DRRS|HSAL4|MGC133050|ZNF797|dJ1112F19.1
Gene Description sal-like 4 (Drosophila)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq PKEILAPSVNVDPVVWNQYTSMLNGGLAVKTNEISVIQSGGVPTLPVSLGATSVVNNATVSKMDGSQSGISADVEKPSATDGVPKHQFPHFLEENKIAVS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SALL4 (NP_065169, 954 a.a. ~ 1053 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 57167

Enviar un mensaje


SALL4 polyclonal antibody (A01)

SALL4 polyclonal antibody (A01)