TRIM54 monoclonal antibody (M02), clone 2G9
  • TRIM54 monoclonal antibody (M02), clone 2G9

TRIM54 monoclonal antibody (M02), clone 2G9

Ref: AB-H00057159-M02
TRIM54 monoclonal antibody (M02), clone 2G9

Información del producto

Mouse monoclonal antibody raised against a partial recombinant TRIM54.
Información adicional
Size 100 ug
Gene Name TRIM54
Gene Alias MURF|MURF-3|RNF30
Gene Description tripartite motif-containing 54
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq PILASQNTKIIDSELSDGIAMLVAGNDRVQAVITQMEEVCQTIEDNSRRQKQLLNQRFESLCAVLEERK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TRIM54 (NP_115935, 186 a.a. ~ 254 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 57159
Clone Number 2G9
Iso type IgG2b Kappa

Enviar un mensaje


TRIM54 monoclonal antibody (M02), clone 2G9

TRIM54 monoclonal antibody (M02), clone 2G9