SMURF1 purified MaxPab rabbit polyclonal antibody (D01P)
  • SMURF1 purified MaxPab rabbit polyclonal antibody (D01P)

SMURF1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00057154-D01P
SMURF1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human SMURF1 protein.
Información adicional
Size 100 ug
Gene Name SMURF1
Gene Alias KIAA1625
Gene Description SMAD specific E3 ubiquitin protein ligase 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,PLA-Ce
Immunogen Prot. Seq MSNPGTRRNGSSIKIRLTVLCAKNLAKKDFFRLPDPFAKIVVDGSGQCHSTDTVKNTLDPKWNQHYDLYVGKTDSITISVWNHKKIHKKQGAGFLGCVRLLSNAISRLKDTGYQRLDLCKLNPSDTDAVRGQIVVSLQTRDRIGTGGSVVDCRGLLENEGTVYEDSGPGRPLSCFMEEPAPYTDSTGAAAGGGNCRFVESPSQDQRLQAQRLRNPDVRGSLQTPQNRPHGHQSPELPEGYEQRTTVQGQVYFLHT
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SMURF1 (NP_851994.1, 1 a.a. ~ 731 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 57154

Enviar un mensaje


SMURF1 purified MaxPab rabbit polyclonal antibody (D01P)

SMURF1 purified MaxPab rabbit polyclonal antibody (D01P)