SMURF1 polyclonal antibody (A01)
  • SMURF1 polyclonal antibody (A01)

SMURF1 polyclonal antibody (A01)

Ref: AB-H00057154-A01
SMURF1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant SMURF1.
Información adicional
Size 50 uL
Gene Name SMURF1
Gene Alias KIAA1625
Gene Description SMAD specific E3 ubiquitin protein ligase 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq DSGPGRPLSCFMEEPAPYTDSTGAAAGGGNCRFVESPSQDQRLQAQRLRNPDVRGSLQTPQNRPHGHQSPELPEGYEQRTTVQGQVYFLHTQTGVSTWHDPRIP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SMURF1 (NP_065162, 165 a.a. ~ 268 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 57154

Enviar un mensaje


SMURF1 polyclonal antibody (A01)

SMURF1 polyclonal antibody (A01)