SLC44A2 monoclonal antibody (M02), clone 1D5
  • SLC44A2 monoclonal antibody (M02), clone 1D5

SLC44A2 monoclonal antibody (M02), clone 1D5

Ref: AB-H00057153-M02
SLC44A2 monoclonal antibody (M02), clone 1D5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SLC44A2.
Información adicional
Size 100 ug
Gene Name SLC44A2
Gene Alias CTL2|DKFZp666A071|FLJ44586|PP1292
Gene Description solute carrier family 44, member 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq YLNARSSRDFEYYKQFCVPGFKNNKGVAEVLRDGDCPAVLIPSKPLARRCFPAIHAYKGVLMVGNETTYEDGHGSRKNITDLVEGAKKANGVLEARQLAMRIFEDYTV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SLC44A2 (AAH40556, 123 a.a. ~ 230 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 57153
Clone Number 1D5
Iso type IgG2b Kappa

Enviar un mensaje


SLC44A2 monoclonal antibody (M02), clone 1D5

SLC44A2 monoclonal antibody (M02), clone 1D5