SCYL3 monoclonal antibody (M01), clone 3D3
  • SCYL3 monoclonal antibody (M01), clone 3D3

SCYL3 monoclonal antibody (M01), clone 3D3

Ref: AB-H00057147-M01
SCYL3 monoclonal antibody (M01), clone 3D3

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SCYL3.
Información adicional
Size 100 ug
Gene Name SCYL3
Gene Alias PACE-1|PACE1|RP1-97P20.2
Gene Description SCY1-like 3 (S. cerevisiae)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq SLTEESMPWKSSLPQKISLVQRGDDADQIEPPKVSSQERPLKVPSELGLGEEFTIQVKKKPVKDPEMDWFADMIPEIKPSAAFLILPELRTEMVPKKDDVSPVMQFSS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SCYL3 (NP_065156.4, 553 a.a. ~ 660 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 57147
Clone Number 3D3
Iso type IgG2a Kappa

Enviar un mensaje


SCYL3 monoclonal antibody (M01), clone 3D3

SCYL3 monoclonal antibody (M01), clone 3D3