CD177 purified MaxPab rabbit polyclonal antibody (D01P)
  • CD177 purified MaxPab rabbit polyclonal antibody (D01P)

CD177 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00057126-D01P
CD177 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human CD177 protein.
Información adicional
Size 100 ug
Gene Name CD177
Gene Alias HNA2A|NB1|PRV1
Gene Description CD177 molecule
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MSPVLLLALLGFILPLPGVQALLCQFGTVQHVWKVSDLPRQWTPKNTSCDSGLGCQDTLMLIESGPQVSLVLSKGCTEAKDQEPRVTEHRMGPGLSLISYTFVCRQEDFCNNLVNSLPLWAPQPPADPGSLRCPVCLSMEGCLEGTTEEICPKGTTHCYDGLLRLRGGGIFSNLRVQGCMPQPGCNLLNGTQEIGPVGMTENCNRKDFLTCHRGTTIMTHGNLAQEPTDWTTSNTEMCEVGQVCQETLLLLDVGL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CD177 (AAH29167.1, 1 a.a. ~ 437 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 57126

Enviar un mensaje


CD177 purified MaxPab rabbit polyclonal antibody (D01P)

CD177 purified MaxPab rabbit polyclonal antibody (D01P)