INTS12 purified MaxPab mouse polyclonal antibody (B01P)
  • INTS12 purified MaxPab mouse polyclonal antibody (B01P)

INTS12 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00057117-B01P
INTS12 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human INTS12 protein.
Información adicional
Size 50 ug
Gene Name INTS12
Gene Alias INT12|PHF22|SBBI22
Gene Description integrator complex subunit 12
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MAATVNLELDPIFLKALGFLHSKSKDSAEKLKALLDESLARGIDSSYRPSQKDVEPPKISSTKNISIKQEPKISSSLPSGNNNGKVLTTEKVKKEAEKRPADKMKSDITEGVDIPKKPRLEKPETQSSPITVQSSKDLPMADLSSFEETSADDFAMEMGLACVVCRQMMVASGNQLVECQECHNLYHRDCHKPQVTDKEANDPRLVWYCARCTRQMKRMAQKTQKPPQKPAPAVVSVTPAVKDPLVKKPETKLKQ
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen INTS12 (NP_065128.2, 1 a.a. ~ 462 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 57117

Enviar un mensaje


INTS12 purified MaxPab mouse polyclonal antibody (B01P)

INTS12 purified MaxPab mouse polyclonal antibody (B01P)