HRASLS polyclonal antibody (A01)
  • HRASLS polyclonal antibody (A01)

HRASLS polyclonal antibody (A01)

Ref: AB-H00057110-A01
HRASLS polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant HRASLS.
Información adicional
Size 50 uL
Gene Name HRASLS
Gene Alias A-C1|H-REV107|HRASLS1|HSD28
Gene Description HRAS-like suppressor
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq SAKSVFSSKALVKMQLLKDVVGNDTYRINNKYDETYPPLPVEEIIKRSEFVIGQEVAYNLLVNNCEHFVTLLRYGEGVSEQANR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen HRASLS (NP_065119, 55 a.a. ~ 138 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 57110

Enviar un mensaje


HRASLS polyclonal antibody (A01)

HRASLS polyclonal antibody (A01)