PNPLA2 monoclonal antibody (M01), clone 2H1
  • PNPLA2 monoclonal antibody (M01), clone 2H1

PNPLA2 monoclonal antibody (M01), clone 2H1

Ref: AB-H00057104-M01
PNPLA2 monoclonal antibody (M01), clone 2H1

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PNPLA2.
Información adicional
Size 100 ug
Gene Name PNPLA2
Gene Alias 1110001C14Rik|ATGL|DESNUTRIN|DKFZp667M109|FP17548|PEDF-R|TTS-2.2|TTS2
Gene Description patatin-like phospholipase domain containing 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq SFTIRLLEWLPDVPEDIRWMKEQTGSICQYLVMRAKRKLGRHLPSRLPEQVELRRVQSLPSVPLSCAAYREALPGWMRNNLSLGDALAKWEECQRQLLLG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PNPLA2 (NP_065109, 347 a.a. ~ 446 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 57104
Clone Number 2H1
Iso type IgG2a Kappa

Enviar un mensaje


PNPLA2 monoclonal antibody (M01), clone 2H1

PNPLA2 monoclonal antibody (M01), clone 2H1