PNPLA2 polyclonal antibody (A01)
  • PNPLA2 polyclonal antibody (A01)

PNPLA2 polyclonal antibody (A01)

Ref: AB-H00057104-A01
PNPLA2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant PNPLA2.
Información adicional
Size 50 uL
Gene Name PNPLA2
Gene Alias 1110001C14Rik|ATGL|DESNUTRIN|DKFZp667M109|FP17548|PEDF-R|TTS-2.2|TTS2
Gene Description patatin-like phospholipase domain containing 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq SFTIRLLEWLPDVPEDIRWMKEQTGSICQYLVMRAKRKLGRHLPSRLPEQVELRRVQSLPSVPLSCAAYREALPGWMRNNLSLGDALAKWEECQRQLLLG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PNPLA2 (NP_065109, 347 a.a. ~ 446 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 57104

Enviar un mensaje


PNPLA2 polyclonal antibody (A01)

PNPLA2 polyclonal antibody (A01)