AVEN monoclonal antibody (M08), clone 2B10
  • AVEN monoclonal antibody (M08), clone 2B10

AVEN monoclonal antibody (M08), clone 2B10

Ref: AB-H00057099-M08
AVEN monoclonal antibody (M08), clone 2B10

Información del producto

Mouse monoclonal antibody raised against a partial recombinant AVEN.
Información adicional
Size 100 ug
Gene Name AVEN
Gene Alias PDCD12
Gene Description apoptosis, caspase activation inhibitor
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq APRGSRREPGGWGAGASAPVEDDSDAETYGEENDEQGNYSKRKIVSNWDRYQDIEKEVNNESGESQRGTDFSVLLSSAGDSFSQFRFAEEKEWDSEASCP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen AVEN (NP_065104.1, 71 a.a. ~ 170 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 57099
Clone Number 2B10
Iso type IgG2b Kappa

Enviar un mensaje


AVEN monoclonal antibody (M08), clone 2B10

AVEN monoclonal antibody (M08), clone 2B10