TRIM49 monoclonal antibody (M03), clone 3H8
  • TRIM49 monoclonal antibody (M03), clone 3H8

TRIM49 monoclonal antibody (M03), clone 3H8

Ref: AB-H00057093-M03
TRIM49 monoclonal antibody (M03), clone 3H8

Información del producto

Mouse monoclonal antibody raised against a partial recombinant TRIM49.
Información adicional
Size 100 ug
Gene Name TRIM49
Gene Alias RNF18
Gene Description tripartite motif-containing 49
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq ILHRSESVLLHMPQPLNPELSAGPITGLRDRLNQFRVHITLHHEEANNDIFLYEILRSMCIGCDHQDVPYFTATPRSFLAWGVQTFTSGK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TRIM49 (NP_065091, 251 a.a. ~ 340 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 57093
Clone Number 3H8
Iso type IgG2a Kappa

Enviar un mensaje


TRIM49 monoclonal antibody (M03), clone 3H8

TRIM49 monoclonal antibody (M03), clone 3H8