UTP3 purified MaxPab mouse polyclonal antibody (B01P)
  • UTP3 purified MaxPab mouse polyclonal antibody (B01P)

UTP3 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00057050-B01P
UTP3 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human UTP3 protein.
Información adicional
Size 50 ug
Gene Name UTP3
Gene Alias CRL1|CRLZ1|FLJ23256|SAS10
Gene Description UTP3, small subunit (SSU) processome component, homolog (S. cerevisiae)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,IF
Immunogen Prot. Seq MVGRSRRRGAAKWAAVRAKAGPTLTDENGDDLGLPPSPGDTSYYQDQVDDFHEARSRAALAKGWNEVQSGDEEDGEEEEEEVLALDMDDEDDEDGGNAGEEEEEENADDDGGSSVQSEAEASVDPSLSWGQRKKLYYDTDYGSKSRGRQSQQEAEEEEREEEEEAQIIQRRLAQALQEDDFGVAWVEAFAKPVPQVDEAETRVVKDLAKVSVKEKLKMLRKESPELLELIEDLKVKLTEVKDELEPLLELVEQGI
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen UTP3 (NP_065101.1, 1 a.a. ~ 479 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 57050

Enviar un mensaje


UTP3 purified MaxPab mouse polyclonal antibody (B01P)

UTP3 purified MaxPab mouse polyclonal antibody (B01P)