PLSCR3 MaxPab mouse polyclonal antibody (B01P)
  • PLSCR3 MaxPab mouse polyclonal antibody (B01P)

PLSCR3 MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00057048-B01P
PLSCR3 MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human PLSCR3 protein.
Información adicional
Size 50 ug
Gene Name PLSCR3
Gene Alias -
Gene Description phospholipid scramblase 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MAGYLPPKGYAPSPPPPYPVTPGYPEPALHPGPGQAPVPAQVPAPAPGFALFPSPGPVALGSAAPFLPLPGVPSGLEFLVQIDQILIHQKAERVETFLGWETCNRYELRSGAGQPLGQAAEESNCCARLCCGARRPLRVRLADPGDRELLRLLRPLHCGCSCCPCGLQEMEVQAPPGTTIGHVLQTWHPFLPKFSIQDADRQTVLRVVGPCWTCGCGTDTNFEVKTRDESRSVGRISKQWGGLVREALTDADDFG
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PLSCR3 (AAH11735.1, 1 a.a. ~ 295 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 57048

Enviar un mensaje


PLSCR3 MaxPab mouse polyclonal antibody (B01P)

PLSCR3 MaxPab mouse polyclonal antibody (B01P)