PLSCR3 polyclonal antibody (A01)
  • PLSCR3 polyclonal antibody (A01)

PLSCR3 polyclonal antibody (A01)

Ref: AB-H00057048-A01
PLSCR3 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant PLSCR3.
Información adicional
Size 50 uL
Gene Name PLSCR3
Gene Alias -
Gene Description phospholipid scramblase 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MAGYLPPKGYAPSPPPPYPVTPGYPEPALHPGPGQAPVPAQVPAPAPGFALFPSPGPVALGSAAPFLPLPGVPSGLEFLVQIDQILIHQKAERVETFLGWETCNRYELRSGAGQPLGQAAEESNCCARLCCGARRPLRVRLADPGDRELLRLLRPLHCGCSCCPCGLQEMEVQAPPGTTIGHVLQTWHPFLPKFSIQDADRQTVLRVVGPCWTCGCGTDTNFEVKTRDESRSVGRISKQWGGLVREALTDADDFG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PLSCR3 (AAH11735, 1 a.a. ~ 295 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 57048

Enviar un mensaje


PLSCR3 polyclonal antibody (A01)

PLSCR3 polyclonal antibody (A01)