TWSG1 monoclonal antibody (M01), clone 6E6
  • TWSG1 monoclonal antibody (M01), clone 6E6

TWSG1 monoclonal antibody (M01), clone 6E6

Ref: AB-H00057045-M01
TWSG1 monoclonal antibody (M01), clone 6E6

Información del producto

Mouse monoclonal antibody raised against a partial recombinant TWSG1.
Información adicional
Size 100 ug
Gene Name TWSG1
Gene Alias TSG
Gene Description twisted gastrulation homolog 1 (Drosophila)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq AEELSHHENLVSFLETVNQPHHQNVSVPSNNVHAPYSSDKEHMCTVVYFDDCMSIHQCKISCESMGASKYRWFHNACCECIGPECIDYGSKTVKCMNCMF
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TWSG1 (NP_065699, 124 a.a. ~ 223 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 57045
Clone Number 6E6
Iso type IgG3 Kappa

Enviar un mensaje


TWSG1 monoclonal antibody (M01), clone 6E6

TWSG1 monoclonal antibody (M01), clone 6E6