RARSL purified MaxPab mouse polyclonal antibody (B01P)
  • RARSL purified MaxPab mouse polyclonal antibody (B01P)

RARSL purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00057038-B01P
RARSL purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human RARSL protein.
Información adicional
Size 50 ug
Gene Name RARS2
Gene Alias ArgRS|DALRD2|MGC14993|MGC23778|PCH6|PRO1992|RARSL|dJ382I10.6
Gene Description arginyl-tRNA synthetase 2, mitochondrial
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MACGFRRAIACQLSRVLNLPPENLITSISAVPISQKEEVADFQLSVDSLLEKDNDHSRPDIQVQAKRLAEKLRCDTVVSEISTGQRTVNFKINRELLTKTVLQQVIEDGSKYGLKSELFSGLPQKKIVVEFSSPNVAKKFHVGHLRSTIIGNFIANLKEALGHQVIRINYLGDWGMQFGLLGTGFQLFGYEEKLQSNPLQHLFEVYVQVNKEAADDKSVAKAAQEFFQRLELGDVQALSLWQKFRDLSIEEYIRV
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen RARSL (NP_064716, 1 a.a. ~ 578 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 57038

Enviar un mensaje


RARSL purified MaxPab mouse polyclonal antibody (B01P)

RARSL purified MaxPab mouse polyclonal antibody (B01P)