CIAPIN1 purified MaxPab rabbit polyclonal antibody (D01P)
  • CIAPIN1 purified MaxPab rabbit polyclonal antibody (D01P)

CIAPIN1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00057019-D01P
CIAPIN1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human CIAPIN1 protein.
Información adicional
Size 100 ug
Gene Name CIAPIN1
Gene Alias 2810413N20Rik|Anamorsin|DRE2|PRO0915
Gene Description cytokine induced apoptosis inhibitor 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MADFGISAGQFVAVVWDKSSPVEALKGLVDKLQALTGNEGRVSVENIKQLLQSAHKESSFDIILSGLVPGSTTLHSAEILAEIARILRPGGCLFLKEPVETAVDNNSKVKTASKLCSALTLSGLVEVKELQREPLTPEEVQSVREHLGHESDNLLFVQITGKKPNFEVGSSRQLKLSITKKSSPSVKPAVDPAAAKLWTLSANDMEDDSMDLIDSDELLDPEDLKKPDPASLRAASCGEGKKRKACKNCTCGLAE
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CIAPIN1 (NP_064709.2, 1 a.a. ~ 312 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 57019

Enviar un mensaje


CIAPIN1 purified MaxPab rabbit polyclonal antibody (D01P)

CIAPIN1 purified MaxPab rabbit polyclonal antibody (D01P)