CCNL1 monoclonal antibody (M01), clone 1F7-1C5
  • CCNL1 monoclonal antibody (M01), clone 1F7-1C5

CCNL1 monoclonal antibody (M01), clone 1F7-1C5

Ref: AB-H00057018-M01
CCNL1 monoclonal antibody (M01), clone 1F7-1C5

Información del producto

Mouse monoclonal antibody raised against a full length recombinant CCNL1.
Información adicional
Size 100 ug
Gene Name CCNL1
Gene Alias BM-001|PRO1073|ania-6a
Gene Description cyclin L1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq MASGPHSTATAAAAASSAAPSAGGSSSGTTTTTTTTTGGILIGDRLYSEVSLTIDHSLIPEERLSPTPSMQDGLDLPSETDLRILGCELIQAAGILLRLPQVAMATGQVLFHRFFYSKSFVKHSFEIVAMACINLASKIEEAPRRIRDVINVFHHLRQLRGKSDQLHLPKPG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CCNL1 (AAH38394, 1 a.a. ~ 172 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 57018
Clone Number 1F7-1C5
Iso type IgG1 kappa

Enviar un mensaje


CCNL1 monoclonal antibody (M01), clone 1F7-1C5

CCNL1 monoclonal antibody (M01), clone 1F7-1C5