CTNNBIP1 polyclonal antibody (A01)
  • CTNNBIP1 polyclonal antibody (A01)

CTNNBIP1 polyclonal antibody (A01)

Ref: AB-H00056998-A01
CTNNBIP1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant CTNNBIP1.
Información adicional
Size 50 uL
Gene Name CTNNBIP1
Gene Alias ICAT|MGC15093
Gene Description catenin, beta interacting protein 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MNREGAPGKSPEEMYIQQKVRVLLMLRKMGSNLTASEEEFLRTYAGVVNSQLSQLPPHSIDQGAEDVVMAFSRSETEDRRQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CTNNBIP1 (NP_064633, 1 a.a. ~ 81 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 56998

Enviar un mensaje


CTNNBIP1 polyclonal antibody (A01)

CTNNBIP1 polyclonal antibody (A01)