TOMM22 monoclonal antibody (M01), clone 4G4
  • TOMM22 monoclonal antibody (M01), clone 4G4

TOMM22 monoclonal antibody (M01), clone 4G4

Ref: AB-H00056993-M01
TOMM22 monoclonal antibody (M01), clone 4G4

Información del producto

Mouse monoclonal antibody raised against a full length recombinant TOMM22.
Información adicional
Size 100 ug
Gene Name TOMM22
Gene Alias 1C9-2|MST065|MSTP065|TOM22
Gene Description translocase of outer mitochondrial membrane 22 homolog (yeast)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,WB-Re,IHC-P,S-ELISA,ELISA,RNAi-Ab,IF
Immunogen Prot. Seq MAAAVAAAGAGEPQSPDELLPKGDAEKPEEELEEDDDEELDETLSERLWGLTEMFPERVRSAAGATFDLSLFVAQKMYRFSRAALWIGTTSFMILVLPVVFETEKLQMEQQQQLQQRQILLGPNTGLSGGMPGALPSLPGKI
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TOMM22 (AAH09363, 1 a.a. ~ 142 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 56993
Clone Number 4G4
Iso type IgG2a Kappa

Enviar un mensaje


TOMM22 monoclonal antibody (M01), clone 4G4

TOMM22 monoclonal antibody (M01), clone 4G4