TOMM22 polyclonal antibody (A01)
  • TOMM22 polyclonal antibody (A01)

TOMM22 polyclonal antibody (A01)

Ref: AB-H00056993-A01
TOMM22 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant TOMM22.
Información adicional
Size 50 uL
Gene Name TOMM22
Gene Alias 1C9-2|MST065|MSTP065|TOM22
Gene Description translocase of outer mitochondrial membrane 22 homolog (yeast)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq MAAAVAAAGAGEPQSPDELLPKGDAEKPEEELEEDDDEELDETLSERLWGLTEMFPERVRSAAGATFDLSLFVAQKMYRFSRAALWIGTTSFMILVLPVVFETEKLQMEQQQQLQQRQILLGPNTGLSGGMPGALPSLPGKI
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TOMM22 (AAH09363, 1 a.a. ~ 142 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 56993

Enviar un mensaje


TOMM22 polyclonal antibody (A01)

TOMM22 polyclonal antibody (A01)