PRTFDC1 purified MaxPab mouse polyclonal antibody (B01P)
  • PRTFDC1 purified MaxPab mouse polyclonal antibody (B01P)

PRTFDC1 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00056952-B01P
PRTFDC1 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human PRTFDC1 protein.
Información adicional
Size 50 ug
Gene Name PRTFDC1
Gene Alias FLJ11888|HHGP
Gene Description phosphoribosyl transferase domain containing 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr
Immunogen Prot. Seq MAGSSEEAPDYGRGVVIMDDWPGYDLNLFTYPQHYYGDLEYVLIPHGIIVDRIERLAKDIMKDIGYSDIMVLCVLKGGYKFCADLVEHLKNISRNSDRFVSMKVDFIRLKSYRNDQSMGEMQIIGGDDLSTLAGKNVLIVEDVVGTGRTMKALLSNIEKYKPNMIKVASLLVKRTSRSDGFRPDYAGFEIPNLFVVGYALDYNEYFRDLNHICVINEHGKEKYRV
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PRTFDC1 (NP_064585.1, 1 a.a. ~ 225 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 56952

Enviar un mensaje


PRTFDC1 purified MaxPab mouse polyclonal antibody (B01P)

PRTFDC1 purified MaxPab mouse polyclonal antibody (B01P)