SMYD2 purified MaxPab rabbit polyclonal antibody (D01P)
  • SMYD2 purified MaxPab rabbit polyclonal antibody (D01P)

SMYD2 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00056950-D01P
SMYD2 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human SMYD2 protein.
Información adicional
Size 100 ug
Gene Name SMYD2
Gene Alias HSKM-B|KMT3C|MGC119305|ZMYND14
Gene Description SET and MYND domain containing 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MRAEGLGGLERFCSPGKGRGLRALQPFQVGDLLFSCPAYAYVLTVNERGNHCEYCFTRKEGLSKCGRCKQAFYCNVECQKEDWPMHKLECSPMVVFGENWNPSETVRLTARILAKQKIHPERTPSEKLLAVKEFESHLDKLDNEKKDLIQSDIAALHHFYSKHLGFPDNDSLVVLFAQVNCNGFTIEDEELSHLGSAIFPDVALMNHSCCPNVIVTYKGTLAEVRAVQEIKPGEEVFTSYIDLLYPTEDRNDRLR
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SMYD2 (NP_064582.1, 1 a.a. ~ 433 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 56950

Enviar un mensaje


SMYD2 purified MaxPab rabbit polyclonal antibody (D01P)

SMYD2 purified MaxPab rabbit polyclonal antibody (D01P)