SMYD2 MaxPab rabbit polyclonal antibody (D01)
  • SMYD2 MaxPab rabbit polyclonal antibody (D01)

SMYD2 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00056950-D01
SMYD2 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human SMYD2 protein.
Información adicional
Size 100 uL
Gene Name SMYD2
Gene Alias HSKM-B|KMT3C|MGC119305|ZMYND14
Gene Description SET and MYND domain containing 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IP
Immunogen Prot. Seq MRAEGLGGLERFCSPGKGRGLRALQPFQVGDLLFSCPAYAYVLTVNERGNHCEYCFTRKEGLSKCGRCKQAFYCNVECQKEDWPMHKLECSPMVVFGENWNPSETVRLTARILAKQKIHPERTPSEKLLAVKEFESHLDKLDNEKKDLIQSDIAALHHFYSKHLGFPDNDSLVVLFAQVNCNGFTIEDEELSHLGSAIFPDVALMNHSCCPNVIVTYKGTLAEVRAVQEIKPGEEVFTSYIDLLYPTEDRNDRLR
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SMYD2 (NP_064582.1, 1 a.a. ~ 433 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 56950

Enviar un mensaje


SMYD2 MaxPab rabbit polyclonal antibody (D01)

SMYD2 MaxPab rabbit polyclonal antibody (D01)