XAB2 monoclonal antibody (M01), clone 1D1-1A9
  • XAB2 monoclonal antibody (M01), clone 1D1-1A9

XAB2 monoclonal antibody (M01), clone 1D1-1A9

Ref: AB-H00056949-M01
XAB2 monoclonal antibody (M01), clone 1D1-1A9

Información del producto

Mouse monoclonal antibody raised against a full length recombinant XAB2.
Información adicional
Size 100 ug
Gene Name XAB2
Gene Alias DKFZp762C1015|HCNP|HCRN|NTC90|SYF1
Gene Description XPA binding protein 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,IHC-P,S-ELISA,ELISA,IF
Immunogen Prot. Seq MVVMARLSRPERPDLVFEEEDLPYEEEIMRNQFSVKCWLRYIEFKQGAPKPRLNQLYERALKLLPCSYKLWYRYLKARRAQVKHRCVTDPAYEDVNNCHERAFVFMHKMPRLWLDYCQFLMDQGRVTHTRRTFDRALRALPITQHSRIWPLYLRFLRSHPLPETAVRGYRRFLKLSPESAEEYIEYLKSSDRLDEAAQRLATVVNDERFVSKAGKSNYQLWHELCDLISQNPDKVQSLNVDAIIRGGLTRFTDQL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen XAB2 (AAH07208.1, 1 a.a. ~ 855 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 56949
Clone Number 1D1-1A9
Iso type IgG2b Kappa

Enviar un mensaje


XAB2 monoclonal antibody (M01), clone 1D1-1A9

XAB2 monoclonal antibody (M01), clone 1D1-1A9