C11orf30 polyclonal antibody (A01)
  • C11orf30 polyclonal antibody (A01)

C11orf30 polyclonal antibody (A01)

Ref: AB-H00056946-A01
C11orf30 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant C11orf30.
Información adicional
Size 50 uL
Gene Name C11orf30
Gene Alias EMSY|FLJ90741|GL002
Gene Description chromosome 11 open reading frame 30
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq PASSEKQTASQVEQPIITQGSSVTKITFEGRQPPTVTKITGGSSVPKLTSPVTSISPIQASEKTAVSDILKMSLMEAQIDTNVEHMIVDPPKKALATS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen C11orf30 (NP_064578, 1081 a.a. ~ 1178 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 56946

Enviar un mensaje


C11orf30 polyclonal antibody (A01)

C11orf30 polyclonal antibody (A01)